PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.S010300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 245aa    MW: 26469 Da    PI: 7.9151
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.S010300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41411401100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkCa++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r d+++slvyeA+ r+rdPvyG++g i++lqqq+++l++
  Manes.S010300.1.p  41 PCAACKLLRRKCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPESQRADTANSLVYEANLRLRDPVYGCMGAISALQQQIQSLQE 132
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        e++++++e
  Manes.S010300.1.p 133 EINSIRSE 140
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.78440141IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4141138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSRDRDRFDE IGKKIKRDTD LSSEMGRRHI LTPGILNTVT PCAACKLLRR KCAEECPFSP  60
YFSPHEPQKF AAVHKVFGAS NVSKMLMEVP ESQRADTANS LVYEANLRLR DPVYGCMGAI  120
SALQQQIQSL QEEINSIRSE IIKHKYREAN TSIISSTEHH HPAALVSSGT LSSIVVPQNI  180
PPLSPAPPPP PPPPPPPPPP PPLSAPSSIV VSSSSSSSIS SLYTPPTSST GYSSISSDNV  240
PYFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078368.11e-100PREDICTED: LOB domain-containing protein 13
SwissprotQ9AT612e-77LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0E4B9M51e-102A0A0E4B9M5_9R
STRINGVIT_13s0067g02380.t016e-99(Vitis vinifera)
STRINGPOPTR_0013s15220.15e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-73LOB domain-containing protein 15